Blog | Pachamama Wholefoods Organic Cafe

Pachamama on Instagram

Allactuallyfreerangeadrenalfatiguealgaealmondbutteralmondbutterchocolatealmondbuttercupsantiinflammatoryantiinflammatorydietantioxidantsanxietyaustraliaaustraliancoffeeayurvedicbamboobeautybeautyproductsblueberriesbooksbpafreebrunchbrunswickbrunswickcafebrunswickcoffeebulkbulksagebulletproofbulletproofcoffeecacaocafecaffeinecalifornianwhitesagecavoodlecavoodlesofinstagramceremonycheekicherriescherrychocolatechookschristmaschristmas2018christmasgiftideachristmasgiftideaschristmashamchristmasshoppingcleanbeautycleaneatscoffeecomfyconditionerbarcouchcrystaljewelrycrystalscushionsdairyfreedessertdessertideadiabetesdogdoggodogsofinstagramdogsofmelbournedogsofpachamamaearthlingeatmeatsustainablyecoecofriendlyefaeggsencyclopediaenergyessentialfattyacidsethicalethicalbusinessethicaleggsethiqueethiquenzfacecleanserbarfairtradefairtradecoffeefermentedfilteredwaterfreerangefreerangeeggsfreerangehamfreshfruitfruitplattergamzesmokehousegheegiftsfromnatureglutenfreegrainfreegrassfedgratitudegrocerguiltfreeguiltfreedesserthairgoalshandmadehappyfithealinghealthhealthbenefitshealthfoodhealthyhealthychristmashealthyfatshealthymelbournehealthyrecipehealthysweetshealthytreatsheathenshighfathisarahhormoneshothurrawhydrationincenseinflammationjewelrykefirketoketocoffeeketogenicketosnackkombuchalaundrybarlibrarylinkinbiolipbalmlipslocallocalbusinesslooseleaflooseleafsageloosesagelovelovetheearthloveyourbodylowcarblushmachupicchumacrosmadeinmelbournemadelaineseggsmctmctoilmelbournemelbournecafemelbournechristmasmelbournecoffeemelbourneeatsmelbournefoodmelbournefoodiemelbourneveganmicroalgaemilkmondaymondayitismotherearthmothernaturenationalgeographicnaturalnaturalbeautynaturalenaturenaturesmagicknewbooksnitratefreehamnoexcuseforsingleusenomoresingleusenuffsaidoldbooksomega3opentodayorganicorganicchristmasorganiccoffeeorganiceggsorganicgrocerorganiclamborganicmeatorganicoorganicturkeypachamamapachamamaskitchenpachamamawholefoodspaleopalosantopavlovapbcupspeanutbutterpicnicplantbasedplantbaseddietplasticfreeplasticfreebeautyplasticfreechristmasplasticfreehaircareprobioticsprocrastibakingproducepromoproteinproteinsourcepublicholidayhoursrainrainydayrawrawchocolaterawmilkreadingreadingnookrecipeideareecesrefinedsugarfreereikirespectyourmotherreusablereusablecupreuseitripesagescreenfreescreenfreetimeseasonalselfloveshampoobarsingleusesmallfarmerssmoothiesmoothiecupsmudgesmudgestickspiritualspringstainlesssteelstayhydratedstaysafesterlingsilverstonefruitstudysnackssugarfreesummersummerdayssummerfruitsundaysundayfundaysundayselflovedaysupplementsupportfarmerssupportlocalsupportorganicsupportsmallbusinesssustainablesustainablegiftideassustainatariansydneyroadbrunswickthegoodlifefarmcotoastietomsorganicmeattreatstreatyoselftreatyourselftruthubereatsveganvegancafeveganchocolateveganeatsveganomega3veganomegasveganproteinvegansofmelbournevegansupplementsvegetablesvegetarianvictoriavitalitywastewastefreewastefreelivingwaterwaterbottlewhitesagewhole30wholefoodsxmasyogiyogibeeryumzeroplasticzerowastezerowastechristmaszerowastegiftszerowastegoals

ZERO WASTE HYDRATION STATION! 💧We’ve got a ton of reusable water bottles (and even smoothie cups) to keep you hydrated in this heat, without wasting any plastic! Insulated, non-insulated, large, small, filtered, non-filtered, take your pick. All BPA free ☺️ Bring it over to @pachamamas_kitchen and get it filled up with filtered water 💦

ZERO WASTE HYDRATION STATION! 💧We’ve got a ton of reusable water bottles (and even smoothie cups) to keep you hydrated in this heat, without wasting any plastic! Insulated, non-insulated, large, small, filtered, non-filtered, take your pick. All BPA free ☺️ Bring it over to @pachamamas_kitchen and get it filled up with filtered water 💦

January 4, 2019

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

LOOK WHAT WE HAVE HERE 👀 after blood, sweat and tears (none of which are in these wraps) we’ve almost perfected our housemade raw, dehydrated wraps! 🌯made from all organic onion, carrot, zucchini, flax, oregano, s&p, and water. 🌱today we have them filled with veggie patties, carrot, zucchini, spinach, vegan feta and beetroot dip in @pachamamas_kitchen 💘

LOOK WHAT WE HAVE HERE 👀 after blood, sweat and tears (none of which are in these wraps) we’ve almost perfected our housemade raw, dehydrated wraps! 🌯made from all organic onion, carrot, zucchini, flax, oregano, s&p, and water. 🌱today we have them filled with veggie patties, carrot, zucchini, spinach, vegan feta and beetroot dip in @pachamamas_kitchen 💘

January 3, 2019

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

As another year flies by we reflect on the year passed. Our community has grown so much and we can’t thank you enough for your support. With our shop renovations starting next week we can’t wait for you to see the new and improved Pachamama Wholefoods and Kitchen. Happy New Year Healthy Humans! Love Christopher, Danielle and the Pacha Fam

As another year flies by we reflect on the year passed. Our community has grown so much and we can’t thank you enough for your support. With our shop renovations starting next week we can’t wait for you to see the new and improved Pachamama Wholefoods and Kitchen. Happy New Year Healthy Humans! Love Christopher, Danielle and the Pacha Fam

January 1, 2019

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

NYE NIBBLE NECESSITIES 🎉🤩🎊No gathering, party or picnic is complete without snacks! We’ve got you sorted for your last minute grazing board goods...• potato chips, popcorn, corn chips• dips: hummus, pesto, beet dip, babaganoush• cheese: vegan (brie, mozzarella, cheddar) and non vegan (goats cheese, camembert, cheddar)• chocolate, including loving earth and panaAnd don’t forget your sustainable party essentials: eco glitter and condoms 💃🏻Open till 7pm 🥂

NYE NIBBLE NECESSITIES 🎉🤩🎊No gathering, party or picnic is complete without snacks! We’ve got you sorted for your last minute grazing board goods…• potato chips, popcorn, corn chips• dips: hummus, pesto, beet dip, babaganoush• cheese: vegan (brie, mozzarella, cheddar) and non vegan (goats cheese, camembert, cheddar)• chocolate, including loving earth and panaAnd don’t forget your sustainable party essentials: eco glitter and condoms 💃🏻Open till 7pm 🥂

December 31, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

We love this photo of our couch + cushion nook at the front of the store, taken by @_noni35mm 💘 perfect spot to chill with a toastie and a book ☺️🥪📖

We love this photo of our couch + cushion nook at the front of the store, taken by @_noni35mm 💘 perfect spot to chill with a toastie and a book ☺️🥪📖

December 29, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

It’s our beloved Daisy’s last shift 😢 She’s been here for four years and knows the store inside out. We’re going to miss her energetic, friendly, caring, and lighthearted nature but are so excited for her adventure to begin as she moves to Spain. Come and say goodbye, and enjoy these juggling bloopers 😂💖✈️👩🏼☹️🌍

It’s our beloved Daisy’s last shift 😢 She’s been here for four years and knows the store inside out. We’re going to miss her energetic, friendly, caring, and lighthearted nature but are so excited for her adventure to begin as she moves to Spain. Come and say goodbye, and enjoy these juggling bloopers 😂💖✈️👩🏼☹️🌍

December 28, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

There’s nothing more refreshing than a kombucha when it’s hot 💖 but sparkling kefir, ACV drinks, and juice are pretty close 🤩

There’s nothing more refreshing than a kombucha when it’s hot 💖 but sparkling kefir, ACV drinks, and juice are pretty close 🤩

December 27, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

🎅🏼🎄 CHRISTMAS TRADING HOURS 🎄🤶🏼The team at Pachamama Wholefoods & Kitchen wishes you all a very happy holiday season and hope that 2019 brings you health, happiness and success 💖

🎅🏼🎄 CHRISTMAS TRADING HOURS 🎄🤶🏼The team at Pachamama Wholefoods & Kitchen wishes you all a very happy holiday season and hope that 2019 brings you health, happiness and success 💖

December 24, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

Check out our schmick new library! We’ve been donated all these educational books, novels and Nat Geos (woo!) so you can keep yourself entertained screen-free while you enjoy a healthy treat from our cafe 📚+☕️=👌🏽

Check out our schmick new library! We’ve been donated all these educational books, novels and Nat Geos (woo!) so you can keep yourself entertained screen-free while you enjoy a healthy treat from our cafe 📚+☕️=👌🏽

December 23, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

HOMEMADE UPCYCLED BONBONS 🤩🎄🤶🏼All you need is:• a toilet roll (one for each bonbon)• leftover wrapping paper (we used @whogivesacraptp adorable Christmas wrapping) or newspaper• string or ribbon• cute fillings or funny jokes, like @hurrawbalm, @ecoglitter, a crystal, a carob bear or chocolate, palo santo, or @santiblends perfume rollersTo assemble, simply put your fillings inside the toilet roll, wrap it in your paper of choice, roll it up, twist the ends around the end of the toilet roll, then secure with some string! So quick and fun to make. Happy bonbon-ing 😍

HOMEMADE UPCYCLED BONBONS 🤩🎄🤶🏼All you need is:• a toilet roll (one for each bonbon)• leftover wrapping paper (we used @whogivesacraptp adorable Christmas wrapping) or newspaper• string or ribbon• cute fillings or funny jokes, like @hurrawbalm, @ecoglitter, a crystal, a carob bear or chocolate, palo santo, or @santiblends perfume rollersTo assemble, simply put your fillings inside the toilet roll, wrap it in your paper of choice, roll it up, twist the ends around the end of the toilet roll, then secure with some string! So quick and fun to make. Happy bonbon-ing 😍

December 22, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

@SPRINGWHOLEFOODS have blown us away with these Christmas puddings! They’re completely gluten free, vegan, and organic, and contain only sprouted and fermented grains, meaning they’re FAR easier to digest than a traditional Christmas pudding. And of course they taste phenomenal 😍 We only have a couple left, so get in quick! 🎅🏼🎄

@SPRINGWHOLEFOODS have blown us away with these Christmas puddings! They’re completely gluten free, vegan, and organic, and contain only sprouted and fermented grains, meaning they’re FAR easier to digest than a traditional Christmas pudding. And of course they taste phenomenal 😍 We only have a couple left, so get in quick! 🎅🏼🎄

December 21, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

LAST CHRISTMAS HAM! 💥 5kg of free range, gluten free, nitrate free deliciousness. Share it with the whole family and have enough for leftovers, or freeze some to enjoy throughout the year! Get in quick, this ethically-raised, happy ham won’t last long 💖

LAST CHRISTMAS HAM! 💥 5kg of free range, gluten free, nitrate free deliciousness. Share it with the whole family and have enough for leftovers, or freeze some to enjoy throughout the year! Get in quick, this ethically-raised, happy ham won’t last long 💖

December 20, 2018

Instagram filter used: Normal Photo taken at: Melbourne, Victoria, Australia...

Yummy Christmas treats for every dietary need or want! We’ve got 🍞 gluten free mince tarts from @gfprecinct 🌿 organic sourdough panettone from @zeallybaysourdough and the incredible ⭐️ organic, Gluten free, vegan, refined sugar free puddings by @springwholefoods 👏🏽 🎅🏽🎄

Yummy Christmas treats for every dietary need or want! We’ve got 🍞 gluten free mince tarts from @gfprecinct 🌿 organic sourdough panettone from @zeallybaysourdough and the incredible ⭐️ organic, Gluten free, vegan, refined sugar free puddings by @springwholefoods 👏🏽 🎅🏽🎄

December 19, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

If you’re looking for a cute kk gift under $20 we have heaps of options including these earring by @keloniakreations (the veggies are our fave 🍆🍉🌽🥕🥦) which are made from sustainable bamboo and are cut and hand painted right here in Melbourne! We also have a cabinet full of crystals 💎 crystal jewellery 💍 natural incense 💐 and smudge sticks 🌿 from @naturesmagickcrystals ❤️💚❤️💚

If you’re looking for a cute kk gift under $20 we have heaps of options including these earring by @keloniakreations (the veggies are our fave 🍆🍉🌽🥕🥦) which are made from sustainable bamboo and are cut and hand painted right here in Melbourne! We also have a cabinet full of crystals 💎 crystal jewellery 💍 natural incense 💐 and smudge sticks 🌿 from @naturesmagickcrystals ❤️💚❤️💚

December 18, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

How good does this PALEO banana bread look 😍 Using @PALEOHERO primal bread mix. All of our @paleohero mixes are 15% off when you buy two or more, including this bread mix (which can be used for savoury or sweet breads) and their pancake and pizza mixes 🥞🍕🍞

How good does this PALEO banana bread look 😍 Using @PALEOHERO primal bread mix. All of our @paleohero mixes are 15% off when you buy two or more, including this bread mix (which can be used for savoury or sweet breads) and their pancake and pizza mixes 🥞🍕🍞

December 17, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

We have EGGciting news here at Pachamama. We now have bulk eggs supplied to us by Toms Paddock. Toms chickens are free to roam the paddocks, living like happy chickens naturally should. And when they become too old to lay, unlike most chickens past their laying days, Toms chickens are not killed, they become pets to loving homes chosen by Tom himself. You can bring your own carton and buy as many or as few eggs as you like, or you can purchase a reusable egg carton from us to bring with you whenever you need eggs. You can’t get more sustainable than that.

We have EGGciting news here at Pachamama. We now have bulk eggs supplied to us by Toms Paddock. Toms chickens are free to roam the paddocks, living like happy chickens naturally should. And when they become too old to lay, unlike most chickens past their laying days, Toms chickens are not killed, they become pets to loving homes chosen by Tom himself. You can bring your own carton and buy as many or as few eggs as you like, or you can purchase a reusable egg carton from us to bring with you whenever you need eggs. You can’t get more sustainable than that.

December 14, 2018

Instagram filter used: Normal View in Instagram ⇒

Really excited to launch today as a @nourishmelbourne community partner. So great to be joining a group of tried, tested, and recommended businesses in the health, wellness & lifestyle space in Melbourne. And we fit all 3 categories!Nourish Melbourne members receive exclusive discounts in-store, head over to their page to learn more.Stay turned for Nourish Melbourne health and wellness events coming up in-store over the coming months. We can't wait!

Really excited to launch today as a @nourishmelbourne community partner. So great to be joining a group of tried, tested, and recommended businesses in the health, wellness & lifestyle space in Melbourne. And we fit all 3 categories!Nourish Melbourne members receive exclusive discounts in-store, head over to their page to learn more.Stay turned for Nourish Melbourne health and wellness events coming up in-store over the coming months. We can’t wait!

December 13, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

We are so excited about these crap-free Christmas recipe books by @sofievankempen and @myfoodreligion 👏🏽💫😍 they are full of delicious gluten and dairy-free recipes for any summer celebration and also have HEALTHY COCKTAILS 🍸 need we say more? Come get your hands on a copy & pick up the ingredients while you’re here 🍒🍰🎅🏽

We are so excited about these crap-free Christmas recipe books by @sofievankempen and @myfoodreligion 👏🏽💫😍 they are full of delicious gluten and dairy-free recipes for any summer celebration and also have HEALTHY COCKTAILS 🍸 need we say more? Come get your hands on a copy & pick up the ingredients while you’re here 🍒🍰🎅🏽

December 11, 2018

Instagram filter used: Normal Photo taken at: Brunswick, Victoria View...

Vegan OMEGA 3 fatty acids 🌱 Omega 3’s are necessary for downgrading inflammation, are great for brain function, cell membranes, hormone signalling, and healthy hair, skin and nails. Omega 6’s on the other hand - although necessary - can increase inflammation. The omega 3 to omega 6 ratio should be between 1:1-1:5, but the standard Australian diet (SAD) contains up to 1:25 due to the high amount of processed oils and fats we consume. Omega 3’s are mainly found in seafood, so for a vegan that eats a lot of grains, nuts and seeds, which are high in omega 6, it can be hard to keep your ratio in range. This supplement is derived from microalgae so gets all the benefits of growing in the ocean but is still technically vegan 🙌🏼

Vegan OMEGA 3 fatty acids 🌱 Omega 3’s are necessary for downgrading inflammation, are great for brain function, cell membranes, hormone signalling, and healthy hair, skin and nails. Omega 6’s on the other hand – although necessary – can increase inflammation. The omega 3 to omega 6 ratio should be between 1:1-1:5, but the standard Australian diet (SAD) contains up to 1:25 due to the high amount of processed oils and fats we consume. Omega 3’s are mainly found in seafood, so for a vegan that eats a lot of grains, nuts and seeds, which are high in omega 6, it can be hard to keep your ratio in range. This supplement is derived from microalgae so gets all the benefits of growing in the ocean but is still technically vegan 🙌🏼

December 10, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

Looking for a zero waste gift for that person who has all the zero waste things already? Look no further than our palo santo sticks and loose leaf bulk sage! Bring your own jar or tin and fill it up with this amazing stuff 🌱💫💎🔥

Looking for a zero waste gift for that person who has all the zero waste things already? Look no further than our palo santo sticks and loose leaf bulk sage! Bring your own jar or tin and fill it up with this amazing stuff 🌱💫💎🔥

December 8, 2018

Instagram filter used: Normal Photo taken at: Brunswick, Victoria View...

While this lovely lass is in India doing her yoga teacher training, we’re here keeping cool sipping Smurf Power smoothies 😍 Open till 7pm for your thirst quenching goodies 🤤

While this lovely lass is in India doing her yoga teacher training, we’re here keeping cool sipping Smurf Power smoothies 😍 Open till 7pm for your thirst quenching goodies 🤤

December 7, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

KETO ICECREAM. #nuffsaid@denada_co now available 🍦

KETO ICECREAM. #nuffsaid@denada_co now available 🍦

December 6, 2018

Instagram filter used: Normal Photo taken at: Melbourne, Victoria, Australia...

Look at those lush locks 😍 all thanks to the amazing plastic-free shampoo and conditioner bars that we are now stocking from @ethiqueworld 💚

Look at those lush locks 😍 all thanks to the amazing plastic-free shampoo and conditioner bars that we are now stocking from @ethiqueworld 💚

December 4, 2018

Instagram filter used: Normal Photo taken at: Brunswick, Victoria View...

Mondayzzzzz 😴 Latte, long black or keto coffee? ☕️😍

Mondayzzzzz 😴 Latte, long black or keto coffee? ☕️😍

December 3, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

These beautiful new pieces and more just joined our crystal collection 💎🔮💫 coming very soon: more smudge sticks, a whole lot more palo santo and BULK loose leaf sage! 🌱#zerowastechristmas

These beautiful new pieces and more just joined our crystal collection 💎🔮💫 coming very soon: more smudge sticks, a whole lot more palo santo and BULK loose leaf sage! 🌱#zerowastechristmas

December 1, 2018

Instagram filter used: Normal Photo taken at: Melbourne, Victoria, Australia...

@romeythecavoodle chilling on the snuggle pit 😍🐩

@romeythecavoodle chilling on the snuggle pit 😍🐩

November 30, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

Have you tried making your own kombucha or kefir before? It’s so easy once you have a starter ‘SCOBY’ or ‘grains’. Such a fun and cheap way to add some extra fermented foods into your diet 🤩 @yogibeerkombucha products come with a free ebook with everything you need to know about making your own probiotic rich goodies 💛

Have you tried making your own kombucha or kefir before? It’s so easy once you have a starter ‘SCOBY’ or ‘grains’. Such a fun and cheap way to add some extra fermented foods into your diet 🤩 @yogibeerkombucha products come with a free ebook with everything you need to know about making your own probiotic rich goodies 💛

November 29, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

Hellooooo keto goodies! We are now fully stocked with these tried, tested and brand new products 🌟 if you have any questions about the keto diet don’t hesitate to come in and speak to one of our naturopaths, while it’s great for fat loss it’s not for everyone and shouldn’t be used long term 🔥🍩💪🏽

November 28, 2018

Instagram filter used: Normal Photo taken at: Brunswick, Victoria View...

When it comes to upcycled, zero waste gifts we know what’s up. Check out these cute epsom jars we made using recycled jars, our bulk Epsom salts and a creative combinations of essential oils and flowers. For only $5 they are the perfect stocking-stuffer or addition to your zero waste hamper 💚

When it comes to upcycled, zero waste gifts we know what’s up. Check out these cute epsom jars we made using recycled jars, our bulk Epsom salts and a creative combinations of essential oils and flowers. For only $5 they are the perfect stocking-stuffer or addition to your zero waste hamper 💚

November 25, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

🐠🐟 Finally, a vegan fysh sauce that has clean ingredients, is fodmap friendly, organic, fair trade, paleo, gluten-free & non-GMO.. what a time to be alive (& vegan) 👏🏽💚🌱

🐠🐟 Finally, a vegan fysh sauce that has clean ingredients, is fodmap friendly, organic, fair trade, paleo, gluten-free & non-GMO.. what a time to be alive (& vegan) 👏🏽💚🌱

November 24, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

Unsure of what to get your wellness-loving, gluten free, vegan, low fodmap (etc, etc) friend for Christmas? 🎄Why not throw a fun hamper together? 🤩The opportunities are endless... beeswax wraps, sage smudge sticks, reusable coffee cups, reusable smoothie cups, steel straws, castile soap, essential oils, CHOCOLATE, the list goes on 😍 What else would you put in a healthy hamper? 🎅🏼

Unsure of what to get your wellness-loving, gluten free, vegan, low fodmap (etc, etc) friend for Christmas? 🎄Why not throw a fun hamper together? 🤩The opportunities are endless… beeswax wraps, sage smudge sticks, reusable coffee cups, reusable smoothie cups, steel straws, castile soap, essential oils, CHOCOLATE, the list goes on 😍 What else would you put in a healthy hamper? 🎅🏼

November 22, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

Can you believe Christmas is almost here!? 🤩 Pre-orders are now available for a selection of organic meats and free-range nitrate-free hams. All orders due by 9th December 🎄 Ps: eat meat sustainably 🍖 📸 @gamzesmokehouse

Can you believe Christmas is almost here!? 🤩 Pre-orders are now available for a selection of organic meats and free-range nitrate-free hams. All orders due by 9th December 🎄 Ps: eat meat sustainably 🍖 📸 @gamzesmokehouse

November 20, 2018

Instagram filter used: Normal Photo taken at: Melbourne, Victoria, Australia...

Not only do we care about what we put in our bodies via our mouth, we also care about what goes in the other end! Cotton is one of the most heavily sprayed crops in the world, and the production process of generic pads + tampons often involves a bunch of bleach and additional synthetics. All these chemicals are easily absorbed when they’re in our bodies, which burdens our liver and can affect our hormones... aka no fun at all. Insert @tomorganic pads + tampons here! Or in there! They’re currently 20% off, so come grab some organic goods 💖 📷 @tomorganic

Not only do we care about what we put in our bodies via our mouth, we also care about what goes in the other end! Cotton is one of the most heavily sprayed crops in the world, and the production process of generic pads + tampons often involves a bunch of bleach and additional synthetics. All these chemicals are easily absorbed when they’re in our bodies, which burdens our liver and can affect our hormones… aka no fun at all. Insert @tomorganic pads + tampons here! Or in there! They’re currently 20% off, so come grab some organic goods 💖 📷 @tomorganic

November 19, 2018

Instagram filter used: Normal View in Instagram ⇒

When it comes to eggs, we want to make sure that what you’re buying is ethical and above all the hens are treated well. Most “free range” claims can be misleading, since the standards aren’t well defined. That’s why we stock @madelainesorganiceggs and @thegoodlifefarmco 🥚 They only keep 250 and 300 chooks per hectare respectively, which is far below the free range standards of 10,000 per hectare! Both have plenty more information on their websites and egg cartons so support the little farms doing the right thing 🐓💚

When it comes to eggs, we want to make sure that what you’re buying is ethical and above all the hens are treated well. Most “free range” claims can be misleading, since the standards aren’t well defined. That’s why we stock @madelainesorganiceggs and @thegoodlifefarmco 🥚 They only keep 250 and 300 chooks per hectare respectively, which is far below the free range standards of 10,000 per hectare! Both have plenty more information on their websites and egg cartons so support the little farms doing the right thing 🐓💚

November 18, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

Our vegan + gluten free sausage sizzle is back again, this time raising funds for the @savetheplanetparty! Come and have a chat to Chris (aka Captain Planet) and Bryony about their plans to help climate change 🌏🌭🤤

Our vegan + gluten free sausage sizzle is back again, this time raising funds for the @savetheplanetparty! Come and have a chat to Chris (aka Captain Planet) and Bryony about their plans to help climate change 🌏🌭🤤

November 17, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

Smurf power smoothies on the couch 👌🏼🥜🍇 Congratulations to our amazing Sarah who just finished her naturopathy degree 🤩 She’ll soon be available for appointments in our in-house consultation room ❤️

Smurf power smoothies on the couch 👌🏼🥜🍇 Congratulations to our amazing Sarah who just finished her naturopathy degree 🤩 She’ll soon be available for appointments in our in-house consultation room ❤️

November 16, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

Cherry season is here! 🍒 Which means it’s basically Christmas... 🤩🎄 So watch this space for the arrival of all our Christmas products and specials. If you have any requests that you’d love us to get in for stocking stuffers or for your Christmas soirées, let us know! 💃🏻🎅🏼🎁

Cherry season is here! 🍒 Which means it’s basically Christmas… 🤩🎄 So watch this space for the arrival of all our Christmas products and specials. If you have any requests that you’d love us to get in for stocking stuffers or for your Christmas soirées, let us know! 💃🏻🎅🏼🎁

November 15, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

Exciting news if you care about the environment and are eligible to vote! Our very own Christopher Anderson aka Christopher Planet will be running in the Victorian state election for the seat of Brunswick, with the @savetheplanetparty 🌏 Their number one priority is just that, to declare a climate emergency and take real action on climate change now to save this beautiful planet. Voting started today so if you live in the Brunswick area and see his name on the sheet chuck a ‘1’ next to it 💚 Also come down this Saturday for a vegan sausage sizzle hosted by Christopher and the Save the Planet crew, sign up to be a member of the party (or a planeteer! 👨🏼‍🎤👩🏼‍🎤) they are fairly new to the game so head over to follow their Instagram and show your support 🍃🌳🌱

Exciting news if you care about the environment and are eligible to vote! Our very own Christopher Anderson aka Christopher Planet will be running in the Victorian state election for the seat of Brunswick, with the @savetheplanetparty 🌏 Their number one priority is just that, to declare a climate emergency and take real action on climate change now to save this beautiful planet. Voting started today so if you live in the Brunswick area and see his name on the sheet chuck a ‘1’ next to it 💚 Also come down this Saturday for a vegan sausage sizzle hosted by Christopher and the Save the Planet crew, sign up to be a member of the party (or a planeteer! 👨🏼‍🎤👩🏼‍🎤) they are fairly new to the game so head over to follow their Instagram and show your support 🍃🌳🌱

November 14, 2018

Instagram filter used: Normal Photo taken at: Brunswick, Victoria View...

🔥 AMP-V 🔥 Aside from being one of our FAVOURITE products (especially for all you keto fam) what is it?! 👉🏽🐟 a VEGAN source of essential fatty acids and omegas 3,5,6,7,9⚡️ a non-stimulating pre-workout that assists in fat burning during morning fasted gym sessions🍦perfect for Keto diets and can be used as an appetite suppressant👀 check out the @atpscience website/podcast for more info on this gem!. . . . 📸 @williamdawsonfitness

🔥 AMP-V 🔥 Aside from being one of our FAVOURITE products (especially for all you keto fam) what is it?! 👉🏽🐟 a VEGAN source of essential fatty acids and omegas 3,5,6,7,9⚡️ a non-stimulating pre-workout that assists in fat burning during morning fasted gym sessions🍦perfect for Keto diets and can be used as an appetite suppressant👀 check out the @atpscience website/podcast for more info on this gem!. . . . 📸 @williamdawsonfitness

November 13, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

Have you been introduced to medicinal mushrooms yet? 🍄 Scientists are continuing to prove the incredible powers of these mushrooms, which have been used in traditional Chinese medicine for thousands of years. For example, Lions Mane improves memory and cognition, especially in Alzheimer’s patients, and has even shown to increase brain neuron regeneration. Reishi can enhance immune and liver function, and acts as an antioxidant. Cordyceps supports energy production and can increase endurance, stamina and athletic performance, as well as improve sexual dysfunction. We have these three powerhouses plus more, produced by @superfeast who only use the highest quality mushrooms 🤩Add them to your hot chocolate, coffee, turmeric or matcha latte, or even soups and stews (they’re not heat sensitive). We have @superfeast’s famous Masons Mushrooms blend in the cafe that can be added to your fave hot beverage for only $1 ☕️

Have you been introduced to medicinal mushrooms yet? 🍄 Scientists are continuing to prove the incredible powers of these mushrooms, which have been used in traditional Chinese medicine for thousands of years. For example, Lions Mane improves memory and cognition, especially in Alzheimer’s patients, and has even shown to increase brain neuron regeneration. Reishi can enhance immune and liver function, and acts as an antioxidant. Cordyceps supports energy production and can increase endurance, stamina and athletic performance, as well as improve sexual dysfunction. We have these three powerhouses plus more, produced by @superfeast who only use the highest quality mushrooms 🤩Add them to your hot chocolate, coffee, turmeric or matcha latte, or even soups and stews (they’re not heat sensitive). We have @superfeast’s famous Masons Mushrooms blend in the cafe that can be added to your fave hot beverage for only $1 ☕️

November 12, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

Sunny Saturdays in store ☀️💖

Sunny Saturdays in store ☀️💖

November 10, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

Tropical fruit has to be one of the best things about summer! Do you agree? We have white and yellow peaches, mangoes, pineapples, rockmelon, papaya and more! All ORGANIC 🤩🌈🍍🍑✨🥭

Tropical fruit has to be one of the best things about summer! Do you agree? We have white and yellow peaches, mangoes, pineapples, rockmelon, papaya and more! All ORGANIC 🤩🌈🍍🍑✨🥭

November 9, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

@essentiallyketo energy bars are 2 for $11 🙌🏼 They make a delicious keto snack 🤤 we stock ‘cacao, raspberry & macadamia’, ‘cacao orange & pecan’, ‘cacao, lemon & coconut’, and ‘cacao & mint’ 😍🍫

@essentiallyketo energy bars are 2 for $11 🙌🏼 They make a delicious keto snack 🤤 we stock ‘cacao, raspberry & macadamia’, ‘cacao orange & pecan’, ‘cacao, lemon & coconut’, and ‘cacao & mint’ 😍🍫

November 8, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

It’s a gloomy one today friends, but we are open from 10-5 and waiting for you to come grab a snack or a coffee and chill on the marshmallow couches. Cause you deserve it 👏🏽🌧🍫☕️

It’s a gloomy one today friends, but we are open from 10-5 and waiting for you to come grab a snack or a coffee and chill on the marshmallow couches. Cause you deserve it 👏🏽🌧🍫☕️

November 6, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

How good do these kale chips by @thefitforkfeed look 😍 such a delicious snack or platter/grazing board addition 🍃 head over to her page for this recipe 👆🏼 or massage kale with a little olive oil and your desired spices and throw in the dehydrator (for an hour or so) or oven (for 10 mins - keep an eye on them) and wollah! Crispy kale chips 🤤

How good do these kale chips by @thefitforkfeed look 😍 such a delicious snack or platter/grazing board addition 🍃 head over to her page for this recipe 👆🏼 or massage kale with a little olive oil and your desired spices and throw in the dehydrator (for an hour or so) or oven (for 10 mins – keep an eye on them) and wollah! Crispy kale chips 🤤

November 5, 2018

Instagram filter used: Normal Photo taken at: Melbourne, Victoria, Australia...

50% off @nograineraustralia paleo almond loaf! Slice it up and chuck it in the freezer, ready for a rainy day 👌🏼 We have it on tasting with @botanicalcuisine black gold (like vegemite but better 😛) and also the fruit and walnut loaf with Botanical’s vegan butter 🤤 (breads contain egg)

50% off @nograineraustralia paleo almond loaf! Slice it up and chuck it in the freezer, ready for a rainy day 👌🏼 We have it on tasting with @botanicalcuisine black gold (like vegemite but better 😛) and also the fruit and walnut loaf with Botanical’s vegan butter 🤤 (breads contain egg)

November 3, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

All @MYHEMPLE products are 20% off 💖🌱 a complete plant-based protein full of omega 3 fatty acids 🤩 Sale includes raw hemp seeds, plain protein, morning glory mocha protein, high fibre protein, and vanilla protein with maca and psyllium 💚🌏

All @MYHEMPLE products are 20% off 💖🌱 a complete plant-based protein full of omega 3 fatty acids 🤩 Sale includes raw hemp seeds, plain protein, morning glory mocha protein, high fibre protein, and vanilla protein with maca and psyllium 💚🌏

November 2, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

The best type of rainbow, a chocolate rainbow! All @loving_earth 80g bars are 2 for $11 🌈🤩🍫

The best type of rainbow, a chocolate rainbow! All @loving_earth 80g bars are 2 for $11 🌈🤩🍫

November 1, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

💩💩💩 Having pooping problems? Blend 11 by @goodmix_superfoods can help! We are lucky enough to have the owners of Good Mix here on Friday 11-2 to sample their products and answer all your (poop related) questions 💩💩💩

💩💩💩 Having pooping problems? Blend 11 by @goodmix_superfoods can help! We are lucky enough to have the owners of Good Mix here on Friday 11-2 to sample their products and answer all your (poop related) questions 💩💩💩

October 31, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

Meet Hannah! The beautiful face behind our organic fruit and veggies. Hannah works hard to make sure we have a fresh variety of produce every day for you 🥑🍌🍅 and if you order with us on @yourgrocer, she is the one who packs your orders up most days! Thanks Hannah 👋🏽🌞💚

Meet Hannah! The beautiful face behind our organic fruit and veggies. Hannah works hard to make sure we have a fresh variety of produce every day for you 🥑🍌🍅 and if you order with us on @yourgrocer, she is the one who packs your orders up most days! Thanks Hannah 👋🏽🌞💚

October 30, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

Who is Pachamama? 🌼 She is an Andean fertility goddess who presides over planting and harvesting (she’s basically Mother Nature), so we are extremely grateful to her (and our farmers of course) for all of the wholefoods we are lucky enough to eat everyday, and all the produce and products we have instore for our beautiful customers 💖

Who is Pachamama? 🌼 She is an Andean fertility goddess who presides over planting and harvesting (she’s basically Mother Nature), so we are extremely grateful to her (and our farmers of course) for all of the wholefoods we are lucky enough to eat everyday, and all the produce and products we have instore for our beautiful customers 💖

October 29, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

There’s a new sustainable crew in town! Thanks to @cheeki_bottles you now have #noexcuseforsingleuse 🥤 And just like our coffee incentive, @pachamamas_kitchen will also give you .50c off your smoothie if you bring your own tumbler, jar or container. We really don’t care, as long as it’s reusable ☺️💚🌏

There’s a new sustainable crew in town! Thanks to @cheeki_bottles you now have #noexcuseforsingleuse 🥤 And just like our coffee incentive, @pachamamas_kitchen will also give you .50c off your smoothie if you bring your own tumbler, jar or container. We really don’t care, as long as it’s reusable ☺️💚🌏

October 27, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

Everyone does it, but not everyone talks about it, even though it’s a healthy part of nature. So to make your experience even better, we’re now stocking vegan, non-toxic, planet friendly condoms by @choose_jonny. Not only do they provide the goods, they also promote women’s health worldwide by supporting @iequalchange and are creating conversation about sexual health. They’re packaging is also beautiful and subtle. Win win win 💖 #staysafe

Everyone does it, but not everyone talks about it, even though it’s a healthy part of nature. So to make your experience even better, we’re now stocking vegan, non-toxic, planet friendly condoms by @choose_jonny. Not only do they provide the goods, they also promote women’s health worldwide by supporting @iequalchange and are creating conversation about sexual health. They’re packaging is also beautiful and subtle. Win win win 💖 #staysafe

October 26, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

Saving packaging, one bulk item at a time! 🌏 Come in with your jars, bring them to the counter to be weighed, and then fill them up with your favourite bulk products. We have a limited range at the moment but are constantly adding new products, especially those that you request! At the moment we have a range of nuts, goji berries, cranberries, nutritional yeast, coconut flakes, cacao nibs, corn, and chickpeas. What would you like us to stock in bulk? 💚

Saving packaging, one bulk item at a time! 🌏 Come in with your jars, bring them to the counter to be weighed, and then fill them up with your favourite bulk products. We have a limited range at the moment but are constantly adding new products, especially those that you request! At the moment we have a range of nuts, goji berries, cranberries, nutritional yeast, coconut flakes, cacao nibs, corn, and chickpeas. What would you like us to stock in bulk? 💚

October 25, 2018

Instagram filter used: Normal Photo taken at: Brunswick, Victoria View...

Look who joined the family! 👀 Just in time for summer we have introduced the Zebra Dream minis in your fave flavours.. 💥 AND for the next 2 weeks you can get 2 biggies for $21.99 or 2 smalls for $7.99 🍦🍦 Tag a friend and they have to buy one for you 🤙🏽 #vegan #refinedsugarfree

Look who joined the family! 👀 Just in time for summer we have introduced the Zebra Dream minis in your fave flavours.. 💥 AND for the next 2 weeks you can get 2 biggies for $21.99 or 2 smalls for $7.99 🍦🍦 Tag a friend and they have to buy one for you 🤙🏽 #vegan #refinedsugarfree

October 24, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

As we come into the warmer months, the produce we are getting in is slightly changing 🍍🍉 We now have beautiful organic mangoes, pineapples, papaya and melons, which are replacing out-of-season apples. Other new additions include artichokes and yellow carrots 💛 Eating according to the seasons allows us to eat a diverse diet, which benefits our gut microbiota because we can grow a variety of good bugs, instead of letting a few species take over. Eating seasonal produce also feeds our vital energy because the produce has been freshly picked and has ripened on the tree/bush instead of being stored in cool rooms for months and losing it’s vitality. Not to mention it also saves a ton of greenhouse gases which are created when importing produce from overseas. 🥦🍌🥒🍈🥕🌽#supportlocal

As we come into the warmer months, the produce we are getting in is slightly changing 🍍🍉 We now have beautiful organic mangoes, pineapples, papaya and melons, which are replacing out-of-season apples. Other new additions include artichokes and yellow carrots 💛 Eating according to the seasons allows us to eat a diverse diet, which benefits our gut microbiota because we can grow a variety of good bugs, instead of letting a few species take over. Eating seasonal produce also feeds our vital energy because the produce has been freshly picked and has ripened on the tree/bush instead of being stored in cool rooms for months and losing it’s vitality. Not to mention it also saves a ton of greenhouse gases which are created when importing produce from overseas. 🥦🍌🥒🍈🥕🌽#supportlocal

October 22, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

Sunday mood 🍕🍕🍕 this weather has got us craving all the comfort foods but thanks to @paleohero you can make your own pizza, bread and pancakes without grains, gluten or guilt 😉

Sunday mood 🍕🍕🍕 this weather has got us craving all the comfort foods but thanks to @paleohero you can make your own pizza, bread and pancakes without grains, gluten or guilt 😉

October 21, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

The perfect little oasis to enjoy a refreshing smoothie or kombucha 💖 Hope you’re all enjoying this lovely weather! 🌞

The perfect little oasis to enjoy a refreshing smoothie or kombucha 💖 Hope you’re all enjoying this lovely weather! 🌞

October 19, 2018

Instagram filter used: Normal Photo taken at: Brunswick, Victoria View...

Have you even been to Pachamama if you haven’t met Taylor? 🤩 She brightens up our day, everyday with her hilarious personality and her caring and generous nature. She also makes a dang good coffee ☕️ She’s the cog that turns our cafes wheels and is ready to whip up your weekday smoothies and pacha-cados 🥑

Have you even been to Pachamama if you haven’t met Taylor? 🤩 She brightens up our day, everyday with her hilarious personality and her caring and generous nature. She also makes a dang good coffee ☕️ She’s the cog that turns our cafes wheels and is ready to whip up your weekday smoothies and pacha-cados 🥑

October 18, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

Hey you waste warriors! 👋🏽 Do you love grain-free bread but hate plastic? SO DO WE! So we’ve come up with a solution along with the legends at @nograineraustralia which means you can now preorder and pick up a sexy plastic-packaging-free loaf of their delicious paleo goodies 😍 On top of that you’ll also get 5% off AND orders over $20 get you 2 free choc lava buns 🙀 What’s not to love about that deal?! 👏🏽 Place your order in store, starting today for delivery next Friday!📷 @thefitzroymillsmarket

Hey you waste warriors! 👋🏽 Do you love grain-free bread but hate plastic? SO DO WE! So we’ve come up with a solution along with the legends at @nograineraustralia which means you can now preorder and pick up a sexy plastic-packaging-free loaf of their delicious paleo goodies 😍 On top of that you’ll also get 5% off AND orders over $20 get you 2 free choc lava buns 🙀 What’s not to love about that deal?! 👏🏽 Place your order in store, starting today for delivery next Friday!📷 @thefitzroymillsmarket

October 17, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

Gut health. 💩 It’s a fascinating yet mind boggling topic. Fermented foods like kombucha and sauerkraut are all the rage at the moment, but if your gut has been in the wars did you know that adding fermented foods can be like throwing fuel on the fire? If this is the case, you’d likely benefit more from soothing and healing foods like bone broth and aloe water. Whereas if you’ve been taking antibiotics, been pooping poorly, or your microbiota (the good bacteria living in your gut) is out of whack, fermented foods can be brilliant! Clearly it’s a complicated topic, so if you need some general advice or some more in-depth healing help, come and chat with our naturopaths instore or book a consultation online. We stock all of these products plus more to help you get your gut happy and your bowels regular 🙌🏼

Gut health. 💩 It’s a fascinating yet mind boggling topic. Fermented foods like kombucha and sauerkraut are all the rage at the moment, but if your gut has been in the wars did you know that adding fermented foods can be like throwing fuel on the fire? If this is the case, you’d likely benefit more from soothing and healing foods like bone broth and aloe water. Whereas if you’ve been taking antibiotics, been pooping poorly, or your microbiota (the good bacteria living in your gut) is out of whack, fermented foods can be brilliant! Clearly it’s a complicated topic, so if you need some general advice or some more in-depth healing help, come and chat with our naturopaths instore or book a consultation online. We stock all of these products plus more to help you get your gut happy and your bowels regular 🙌🏼

October 15, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

🌞 SALAD OF THE DAY 🌞 featuring Wasabi leaf (who knew that was a thing? 🤷🏻‍♀️), jackfruit, brown rice noodles, cucumber, carrot, spring onions, coriander and a lime-tamari-sesame dressing. 100% organic, made fresh this morning. 🥗💚🥗 For more pics like this follow @pachamamas_kitchen 💚🥗💚

🌞 SALAD OF THE DAY 🌞 featuring Wasabi leaf (who knew that was a thing? 🤷🏻‍♀️), jackfruit, brown rice noodles, cucumber, carrot, spring onions, coriander and a lime-tamari-sesame dressing. 100% organic, made fresh this morning. 🥗💚🥗 For more pics like this follow @pachamamas_kitchen 💚🥗💚

October 14, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

We’ve been listening to your suggestions and have a whole bunch of new products in store! Our bulk section is slowly expanding too, come check it out! 👀

We’ve been listening to your suggestions and have a whole bunch of new products in store! Our bulk section is slowly expanding too, come check it out! 👀

October 13, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

We hate food waste, so whenever F&V are going a little sad we put it in this box, giving you the option to buy it super cheap. Fruit and vegetables shouldn’t have to meet certain aesthetic standards because like always, it’s what’s on the inside that counts 😊

We hate food waste, so whenever F&V are going a little sad we put it in this box, giving you the option to buy it super cheap. Fruit and vegetables shouldn’t have to meet certain aesthetic standards because like always, it’s what’s on the inside that counts 😊

October 8, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

These lovely ladies, @myfoodreligion and @sofievankempen, will gracing the stage here at Pachamama in a week from today for their gut health and fermenting workshop! They’ll be chatting all about digestion (including poop 💩) and how to improve your gut health, will be doing fermented food demos, and dishing out all of the food samples 🤤 To celebrate we’re giving away a double pass (valued at $90). To enter, simply follow @pachamama_wholefoods, like this post, and tag a friend who you would bring along! Competition ends 11.59pm Sunday night.

These lovely ladies, @myfoodreligion and @sofievankempen, will gracing the stage here at Pachamama in a week from today for their gut health and fermenting workshop! They’ll be chatting all about digestion (including poop 💩) and how to improve your gut health, will be doing fermented food demos, and dishing out all of the food samples 🤤 To celebrate we’re giving away a double pass (valued at $90). To enter, simply follow @pachamama_wholefoods, like this post, and tag a friend who you would bring along! Competition ends 11.59pm Sunday night.

October 4, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

Hey pachamigos, this is Sarah 🙋🏻‍♀️ #hisarah. She’s just weeks away from finishing her naturopathy degree and will soon be available for consultations to help you on your health journey. Until then, you can pick her brain when she’s instore on Mondays and Tuesdays or chat about her love of cooking, hiking, or her side hustle of making natural body products 🧖🏻‍♀️🙌🏼 Or just stare at her luscious ginger locks 😍

Hey pachamigos, this is Sarah 🙋🏻‍♀️ #hisarah. She’s just weeks away from finishing her naturopathy degree and will soon be available for consultations to help you on your health journey. Until then, you can pick her brain when she’s instore on Mondays and Tuesdays or chat about her love of cooking, hiking, or her side hustle of making natural body products 🧖🏻‍♀️🙌🏼 Or just stare at her luscious ginger locks 😍

October 1, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

It’s spring time and our fruit & veg section is blooming 🌸 our prices are lower than ever and you can now see exactly where your food is coming from! Whilst all of our f&v comes from Australia we are working hard on making it as LOCAL as possible which means less food miles for you 🍓🍓🍓

It’s spring time and our fruit & veg section is blooming 🌸 our prices are lower than ever and you can now see exactly where your food is coming from! Whilst all of our f&v comes from Australia we are working hard on making it as LOCAL as possible which means less food miles for you 🍓🍓🍓

September 30, 2018

Instagram filter used: Normal Photo taken at: Melbourne, Victoria, Australia...

Long weekend starts now! 🍻 But we’ll be open 10-5 tomorrow, 9-6 sat and 10-6 sun for all your delicious platter and game day necessities! We’ll also be pumping out UberEATS orders as usual, to keep you nourished when the long weekend shenanigans make it too hard to leave the house 😛🏉🎉

Long weekend starts now! 🍻 But we’ll be open 10-5 tomorrow, 9-6 sat and 10-6 sun for all your delicious platter and game day necessities! We’ll also be pumping out UberEATS orders as usual, to keep you nourished when the long weekend shenanigans make it too hard to leave the house 😛🏉🎉

September 27, 2018

Instagram filter used: Normal Photo taken at: Melbourne, Victoria, Australia...

Such fascinate. Wow. Calling all the health conscious floofers, puppers and cat-doges: your human’s favourite organic shop is now stocking doge and meow food! Much health! So excite! 🐾🐕🐈

Such fascinate. Wow. Calling all the health conscious floofers, puppers and cat-doges: your human’s favourite organic shop is now stocking doge and meow food! Much health! So excite! 🐾🐕🐈

September 25, 2018

Instagram filter used: Normal Photo taken at: Brunswick, Victoria View...

Matcha. You may have heard of it, but what is it exactly? It’s powdered green tea, which can be whisked into hot water and enjoyed on its own, or frothed/blended with hot milk for a yummy matcha latte (we love it with coconut milk). It contains higher amounts of chlorophyll (because it’s grown in the shade) and EGCG (a powerful antioxidant) than standard green tea, and also slightly more caffeine. It’s a great alternative to coffee if you’re trying to wean yourself of caffeine as it contains about half the amount, but because of its high amount of L-theanine, a calming compound, it doesn’t give you any jitters, anxiety, or comedown energy crashes. We stock the beautiful @matcha_maiden, which is certified organic and contains 137x the antioxidants of regular green tea! If you’re feeling witchy, try blending a tsp of matcha, 1/4 tsp maca, and 1 tsp cacao butter with hot coconut or almond milk, or hot water for a delicious, hormone stabilising elixir, or leave the work to us and come in and try one at @pachamamas_kitchen 🍵

Matcha. You may have heard of it, but what is it exactly? It’s powdered green tea, which can be whisked into hot water and enjoyed on its own, or frothed/blended with hot milk for a yummy matcha latte (we love it with coconut milk). It contains higher amounts of chlorophyll (because it’s grown in the shade) and EGCG (a powerful antioxidant) than standard green tea, and also slightly more caffeine. It’s a great alternative to coffee if you’re trying to wean yourself of caffeine as it contains about half the amount, but because of its high amount of L-theanine, a calming compound, it doesn’t give you any jitters, anxiety, or comedown energy crashes. We stock the beautiful @matcha_maiden, which is certified organic and contains 137x the antioxidants of regular green tea! If you’re feeling witchy, try blending a tsp of matcha, 1/4 tsp maca, and 1 tsp cacao butter with hot coconut or almond milk, or hot water for a delicious, hormone stabilising elixir, or leave the work to us and come in and try one at @pachamamas_kitchen 🍵

September 24, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

Are you a procrastibaker? 👋🏽 Hi, us too. We tried these ✨ ALMOND BUTTER CUPS ✨ which are so simple to whip up and sooo easy to snack on when you have a sweet craving, without being naughty 😏 You can find the recipe in our story and all the ingredients in store 👀🍫 We hope you enjoy them as much as we did!

Are you a procrastibaker? 👋🏽 Hi, us too. We tried these ✨ ALMOND BUTTER CUPS ✨ which are so simple to whip up and sooo easy to snack on when you have a sweet craving, without being naughty 😏 You can find the recipe in our story and all the ingredients in store 👀🍫 We hope you enjoy them as much as we did!

September 23, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

Vegan and gluten free sausage sizzle till 3pm or until sold out 🌭 Friends of the Earth are raising money for their work with forest and wildlife conservation 🌏 Come get your snags!

Vegan and gluten free sausage sizzle till 3pm or until sold out 🌭 Friends of the Earth are raising money for their work with forest and wildlife conservation 🌏 Come get your snags!

September 22, 2018

Instagram filter used: Normal Photo taken at: Brunswick, Victoria View...

Do you ever misplace your beloved @hurrawbalmau and then find it months later in a very obscure place? Well nows the time to stock up so you always have one within reach, with 2 for $9.90 until the start of October 😱 We currently have ten delicious flavours, including these Ayurvedic blends: Pitta: coconut, mint + lemongrassKapha: grapefruit, ginger + eucalyptus Vata: almond, cardamon + rose🌈🌈🌈

Do you ever misplace your beloved @hurrawbalmau and then find it months later in a very obscure place? Well nows the time to stock up so you always have one within reach, with 2 for $9.90 until the start of October 😱 We currently have ten delicious flavours, including these Ayurvedic blends: Pitta: coconut, mint + lemongrassKapha: grapefruit, ginger + eucalyptus Vata: almond, cardamon + rose🌈🌈🌈

September 21, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

We go a little crazy over @nograineraustralia’s paleo choc buns 😍 Always available in @pachamamas_kitchen 🍫

We go a little crazy over @nograineraustralia’s paleo choc buns 😍 Always available in @pachamamas_kitchen 🍫

September 20, 2018

Instagram filter used: Normal Photo taken at: Melbourne, Victoria, Australia...

HEY 👋🏽 We are super excited to announce that the amazing Sofie (@sofievankempen) & Shan (@myfoodreligion) will be hosting one of their very popular fermenting workshops at Pachamama Wholefoods! 👏🏽👏🏽 The girls are offering a 15% discount for the first 10 people who book so check that #linkinbio for more info & to get your ticket to a happy gut! 🍶🥕🍖🌱

HEY 👋🏽 We are super excited to announce that the amazing Sofie (@sofievankempen) & Shan (@myfoodreligion) will be hosting one of their very popular fermenting workshops at Pachamama Wholefoods! 👏🏽👏🏽 The girls are offering a 15% discount for the first 10 people who book so check that #linkinbio for more info & to get your ticket to a happy gut! 🍶🥕🍖🌱

September 18, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

Coffee. We love it, and most of you do too. It contains loads of antioxidants and polyphenols, increases cognition, and some studies show that it may lengthen our lifespan and decrease the risk of type 2 diabetes and liver disease. However, some studies say that up to 55% of us have a variation in the enzyme that metabolises caffeine, meaning the caffeine is processed at a slower rate and we feel the effects of it for longer. This can cause symptoms like anxiety, heart palpitations, and can lead to adrenal dysfunction and disrupt hormones. At the end of the day, we all benefit from listening to our own bodies, and sometimes you just NEED a coffee 🙊 If you drink black coffee, try to separate it from meals by an hour because the tannins it contains bind to iron and decrease the amount of iron we are able to absorb. Milk in coffee counteracts this, however it also decreases the polyphenols and antioxidants we absorb from the coffee. If you want to try something with a little less caffeine, pop in for a chai latte (contains similar amounts of antioxidants with less than half the amount of caffeine), turmeric or beetroot latte, or hot choccy ☕️📷 @dimattinacoffee

Coffee. We love it, and most of you do too. It contains loads of antioxidants and polyphenols, increases cognition, and some studies show that it may lengthen our lifespan and decrease the risk of type 2 diabetes and liver disease. However, some studies say that up to 55% of us have a variation in the enzyme that metabolises caffeine, meaning the caffeine is processed at a slower rate and we feel the effects of it for longer. This can cause symptoms like anxiety, heart palpitations, and can lead to adrenal dysfunction and disrupt hormones. At the end of the day, we all benefit from listening to our own bodies, and sometimes you just NEED a coffee 🙊 If you drink black coffee, try to separate it from meals by an hour because the tannins it contains bind to iron and decrease the amount of iron we are able to absorb. Milk in coffee counteracts this, however it also decreases the polyphenols and antioxidants we absorb from the coffee. If you want to try something with a little less caffeine, pop in for a chai latte (contains similar amounts of antioxidants with less than half the amount of caffeine), turmeric or beetroot latte, or hot choccy ☕️📷 @dimattinacoffee

September 17, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

Happy Sunday Self-love Day! Treat yourself the right way today with a healthy smoothie, organic toastie, fairtrade organic coffee or elixir of your choice at our cafe @pachamamaskitchen // Repost from @tiffhall_xo // Smoothie time at @pachamama_wholefoods was a goooooood time for all (but mostly me. Clock that #happyfit smile 😂☺️).

Happy Sunday Self-love Day! Treat yourself the right way today with a healthy smoothie, organic toastie, fairtrade organic coffee or elixir of your choice at our cafe @pachamamaskitchen // Repost from @tiffhall_xo // Smoothie time at @pachamama_wholefoods was a goooooood time for all (but mostly me. Clock that #happyfit smile 😂☺️).

September 16, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

3 more days to get 2 @madebycow cold-pressed raw milks for $11.9 🥛 This nutrient rich milk comes from happy grass fed cows and tastes just like it used to, creamy and delicious 💖

3 more days to get 2 @madebycow cold-pressed raw milks for $11.9 🥛 This nutrient rich milk comes from happy grass fed cows and tastes just like it used to, creamy and delicious 💖

September 15, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

Staff favourite: @loveteaofficial 😍 These organic, naturopath formulated teas not only taste delicious, but they also have targeted blends to help your digestion, immune system, skin, sleep, and even for breastfeeding and women’s wellness. @megshealingkitchen’s faves are the skin glow, cacao chai and dandelion chai 🤤 Available in loose leaf or in pyramid tea bags. They’re also on tasting today!

Staff favourite: @loveteaofficial 😍 These organic, naturopath formulated teas not only taste delicious, but they also have targeted blends to help your digestion, immune system, skin, sleep, and even for breastfeeding and women’s wellness. @megshealingkitchen’s faves are the skin glow, cacao chai and dandelion chai 🤤 Available in loose leaf or in pyramid tea bags. They’re also on tasting today!

September 14, 2018

Instagram filter used: Normal Photo taken at: Brunswick, Victoria View...

Did you miss our vegan sausage sizzle last weekend? 😦🌭 We are very excited that @friends_of_the_earth_ will be hosting our next one THIS SATURDAY 15 SEPTEMBER 👏🏽 💚🌿 put it in your calendars! 🗓 ft vegan sausages by @suzyspoonsvegetarianbutcher 🌭 & gluten free bread from @blackrubybakeries 🍞

Did you miss our vegan sausage sizzle last weekend? 😦🌭 We are very excited that @friends_of_the_earth_ will be hosting our next one THIS SATURDAY 15 SEPTEMBER 👏🏽 💚🌿 put it in your calendars! 🗓 ft vegan sausages by @suzyspoonsvegetarianbutcher 🌭 & gluten free bread from @blackrubybakeries 🍞

September 13, 2018

Instagram filter used: Normal Photo taken at: Brunswick, Victoria View...

New booch, who dis? We now stock the amazing @yogibeerkombucha in Lemon + Turmeric, Ginger Fizz, and Heavenly Hibiscus. Among the other brands we stock we now have 13 different flavours to choose from, helping to keep your guts happy and healthy ☺️🍾

New booch, who dis? We now stock the amazing @yogibeerkombucha in Lemon + Turmeric, Ginger Fizz, and Heavenly Hibiscus. Among the other brands we stock we now have 13 different flavours to choose from, helping to keep your guts happy and healthy ☺️🍾

September 12, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

Fake honey is unfortunately not fake news 🍯 Honeys from big companies like Aldi, IGA and Capilano have tested positive to containing adulterated honey, which means their products contain different sugar syrups mixed into honey. Honey is the only edible product that doesn’t go off, so when consuming the nectar of the gods (bees), be sure to invest in a locally produced, high quality product. We have a range of different honey varieties, all of which taste delicious 🙌🏼

Fake honey is unfortunately not fake news 🍯 Honeys from big companies like Aldi, IGA and Capilano have tested positive to containing adulterated honey, which means their products contain different sugar syrups mixed into honey. Honey is the only edible product that doesn’t go off, so when consuming the nectar of the gods (bees), be sure to invest in a locally produced, high quality product. We have a range of different honey varieties, all of which taste delicious 🙌🏼

September 10, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

NEW ALMOND BUTTER MACHINE, WHO DIS 💃🏻 We now make fresh dry roasted almond butter with local insecticide-free almonds. It’s available in these biodegradable tubs, or bring in your own jar and we’ll fill it up for you 🌏 question is, would you prefer us to make it salted or unsalted?

NEW ALMOND BUTTER MACHINE, WHO DIS 💃🏻 We now make fresh dry roasted almond butter with local insecticide-free almonds. It’s available in these biodegradable tubs, or bring in your own jar and we’ll fill it up for you 🌏 question is, would you prefer us to make it salted or unsalted?

September 8, 2018

Instagram filter used: Juno Photo taken at: Melbourne, Victoria, Australia...

Have you tried kraut chips? 🤤 They’re made from organic sauerkraut and corn flour, which are then fried, and end up tasting like the love child of potato and corn chips. We have plain sea salt, zesty garden veggie, and dill pickle (our fave) flavours. Best of all they’re 2-for-1 until Tuesday 💃🏻🌱🕺🏻

Have you tried kraut chips? 🤤 They’re made from organic sauerkraut and corn flour, which are then fried, and end up tasting like the love child of potato and corn chips. We have plain sea salt, zesty garden veggie, and dill pickle (our fave) flavours. Best of all they’re 2-for-1 until Tuesday 💃🏻🌱🕺🏻

September 7, 2018

Instagram filter used: Juno Photo taken at: Pachamama Wholefoods +...

✨PARTY TIME✨ Can you believe it's been a year since we became the proud faces of Pachamama?! To celebrate we'll be having a one-year birthday party this Sat 8 September with FREE TASTINGS and a VEGAN/GF sausage sizzle! See you there 👋🏽

✨PARTY TIME✨ Can you believe it’s been a year since we became the proud faces of Pachamama?! To celebrate we’ll be having a one-year birthday party this Sat 8 September with FREE TASTINGS and a VEGAN/GF sausage sizzle! See you there 👋🏽

September 6, 2018

Instagram filter used: Normal Photo taken at: Brunswick, Victoria View...

KETO COMBO 💥 Were obsesses with keto coffees here at Pachamama and we want to share the amazing benefits with you all (prolonged release of caffeine and energy, increased cognition, no anxious coffee comedowns). So for the next two weeks, buy a 500ml bottle of @melrosehealth original MCT oil with a jar of ghee (to make your own sustainably energising keto coffee at home) for only $42.99 (normally $50.90). Or for those that don’t want to commit to the big guys, you can grab a 250ml original MCT oil bottle with a smaller jar of @pepesaya ghee for $22.99 (normally $27.20). If you’d like to try before you buy, come and visit @pachamamas_kitchen and try a $4 keto coffee ⚡️⚡️⚡️ 📸 @melrosehealth

KETO COMBO 💥 Were obsesses with keto coffees here at Pachamama and we want to share the amazing benefits with you all (prolonged release of caffeine and energy, increased cognition, no anxious coffee comedowns). So for the next two weeks, buy a 500ml bottle of @melrosehealth original MCT oil with a jar of ghee (to make your own sustainably energising keto coffee at home) for only $42.99 (normally $50.90). Or for those that don’t want to commit to the big guys, you can grab a 250ml original MCT oil bottle with a smaller jar of @pepesaya ghee for $22.99 (normally $27.20). If you’d like to try before you buy, come and visit @pachamamas_kitchen and try a $4 keto coffee ⚡️⚡️⚡️ 📸 @melrosehealth

September 5, 2018

Instagram filter used: Normal Photo taken at: Brunswick, Victoria View...

👊🏽FREE FITNESS SESSION!👊🏽 When you are trying to change the world, it helps to have friends. Roy from the @f.i.t_project (TFP) is on a mission to help the humans of our community become happier and healthier. As we are on the same mission, this is something we can absolutely get behind! Roy is going to be running a free fitness session this Saturday exclusive to Pachamigos. Use the link in bio to sign up!

👊🏽FREE FITNESS SESSION!👊🏽 When you are trying to change the world, it helps to have friends. Roy from the @f.i.t_project (TFP) is on a mission to help the humans of our community become happier and healthier. As we are on the same mission, this is something we can absolutely get behind! Roy is going to be running a free fitness session this Saturday exclusive to Pachamigos. Use the link in bio to sign up!

September 4, 2018

Instagram filter used: Normal Photo taken at: Brunswick, Victoria View...

Vitamin D ☀️ We get it from the sun, but in the winter months in Melbourne it can be extremely difficult to absorb. Due to the very low levels of UV rays, we are required to spend multiple hours in the sun per week, without sunscreen and clothes covering every surface of our body 😅🧤🧣🧢🙅🏻‍♀️ But considering the sun is often hibernating behind the clouds, and that time spent indoors by a heater is more appealing than shivering outside in the cold, many Australians are deficient in the vitamin. VicHealth found that even when Melbournians met the recommended exposure in winter, their levels still weren’t adequate. This can lead to symptoms such as SAD (seasonal affective disorder), depression, fatigue, poor immune function, autoimmunity and decreased bone density. To prevent this as much as possible, we can supplement with vitamin D3 (the active form) and consume foods such as oily fish, cod liver oil, and eggs. Interestingly, if you leave mushrooms in the sun, they act like the human skin and produce vitamin D, which you can then absorb when you eat them. If you believe your levels may be low (like the rest of us 😬), come and chat to our in-house naturopath about the best options for you.

Vitamin D ☀️ We get it from the sun, but in the winter months in Melbourne it can be extremely difficult to absorb. Due to the very low levels of UV rays, we are required to spend multiple hours in the sun per week, without sunscreen and clothes covering every surface of our body 😅🧤🧣🧢🙅🏻‍♀️ But considering the sun is often hibernating behind the clouds, and that time spent indoors by a heater is more appealing than shivering outside in the cold, many Australians are deficient in the vitamin. VicHealth found that even when Melbournians met the recommended exposure in winter, their levels still weren’t adequate. This can lead to symptoms such as SAD (seasonal affective disorder), depression, fatigue, poor immune function, autoimmunity and decreased bone density. To prevent this as much as possible, we can supplement with vitamin D3 (the active form) and consume foods such as oily fish, cod liver oil, and eggs. Interestingly, if you leave mushrooms in the sun, they act like the human skin and produce vitamin D, which you can then absorb when you eat them. If you believe your levels may be low (like the rest of us 😬), come and chat to our in-house naturopath about the best options for you.

September 3, 2018

Instagram filter used: Clarendon Photo taken at: Melbourne, Victoria, Australia...

✨HAPPY FATHERS DAY✨ Come try our fair trade organic coffee by @dimattinacoffee - served up your way in the @pachamamas_kitchen ☕️ Bring your dad in for a visit today and his coffee is on us! 👏🏽👏🏽

✨HAPPY FATHERS DAY✨ Come try our fair trade organic coffee by @dimattinacoffee – served up your way in the @pachamamas_kitchen ☕️ Bring your dad in for a visit today and his coffee is on us! 👏🏽👏🏽

September 2, 2018

Instagram filter used: Normal Photo taken at: Melbourne, Victoria, Australia...

This is Daisy 💁🏻‍♀️🌼 She’s been working here for 4 years and does an amazing job of keeping the fruit + veg and general stock looking shmick, as well as assisting our beautiful customers. As someone with coeliac disease, she has extensive knowledge on gluten free living and can help you with any questions you might have. She’s heading to Madrid in January to teach English, so pop in for a chat before she goes and help her practice her Español 🇪🇸💃🏻

This is Daisy 💁🏻‍♀️🌼 She’s been working here for 4 years and does an amazing job of keeping the fruit + veg and general stock looking shmick, as well as assisting our beautiful customers. As someone with coeliac disease, she has extensive knowledge on gluten free living and can help you with any questions you might have. She’s heading to Madrid in January to teach English, so pop in for a chat before she goes and help her practice her Español 🇪🇸💃🏻

September 1, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

As women generally use far more beauty products than men, they have a far higher toxic load from the chemicals these products contain. To combat this, we stock a large non-toxic beauty range, including these Herbatint hair colours that our fruit and veg guru, Hannah, loves. Blonde, black and everything in between 🙌🏼💆🏽‍♀️

As women generally use far more beauty products than men, they have a far higher toxic load from the chemicals these products contain. To combat this, we stock a large non-toxic beauty range, including these Herbatint hair colours that our fruit and veg guru, Hannah, loves. Blonde, black and everything in between 🙌🏼💆🏽‍♀️

August 31, 2018

Instagram filter used: Normal Photo taken at: Brunswick, Victoria View...

🍼 BUB FRIENDLY ZONE 🍼 Hey mamas and papas, we just wanted to let you know about our awesome new CHANGE-TABLE for you to use in our bathroom. That means you can enjoy your shop and coffee care-free and bub stays happy too! 👶🏼👏🏽 Thanks for the 📷 @danielleklaw

🍼 BUB FRIENDLY ZONE 🍼 Hey mamas and papas, we just wanted to let you know about our awesome new CHANGE-TABLE for you to use in our bathroom. That means you can enjoy your shop and coffee care-free and bub stays happy too! 👶🏼👏🏽 Thanks for the 📷 @danielleklaw

August 30, 2018

Instagram filter used: Normal Photo taken at: Brunswick View in...

FOUR DAYS TILL FATHERS DAY! 👨🏾🧔🏽👴🏼👳🏻‍♂️ Have you got a pressie sorted? Lucky for you we have 20% off some products that can replace your dads potentially chemical-laden alternatives, like @dindinaturals and @drbronners_australia shaving soap, bear soap, and hand lotion. We also have 20% the WHOLE range of @superfeast mushies, incase your dad is in need of some physical, mental or all round support. Plus, @chowcacao bars are 2 for $9.99, and all dads love choccy right?

FOUR DAYS TILL FATHERS DAY! 👨🏾🧔🏽👴🏼👳🏻‍♂️ Have you got a pressie sorted? Lucky for you we have 20% off some products that can replace your dads potentially chemical-laden alternatives, like @dindinaturals and @drbronners_australia shaving soap, bear soap, and hand lotion. We also have 20% the WHOLE range of @superfeast mushies, incase your dad is in need of some physical, mental or all round support. Plus, @chowcacao bars are 2 for $9.99, and all dads love choccy right?

August 29, 2018

Instagram filter used: Normal Photo taken at: Melbourne, Victoria, Australia...

☕️ + 🍰 What's your favourite coffee & snack combo? We don't mind this afternoon pick-me-up from @caffeine.and.ethanol 👆🏽 our keto 'bulletproof' coffee with a @conscious.cravings.co raspberry lamington 😍 match made in heaven!

☕️ + 🍰 What’s your favourite coffee & snack combo? We don’t mind this afternoon pick-me-up from @caffeine.and.ethanol 👆🏽 our keto ‘bulletproof’ coffee with a @conscious.cravings.co raspberry lamington 😍 match made in heaven!

August 28, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

PROTEIN. Why is it so important? Not only is it necessary for muscle recovery and repair for those that hit the gym, it’s also a major part of the neurotransmitters we produce that keep us happy and motivated 😊 Without enough protein we don’t have the building blocks to make all the chemicals our brains thrive on, which can lead to depression and mood disorders 😔 Protein also keeps us fuller for longer and stabilises our blood sugar, so by incorporating a palm sized amount with each meal, it will prevent our blood sugar levels spiking and crashing, and avoid hanger and the need to snack throughout the day. Whether you’re vegan, vego, omnivore, or paleo, we have a huge range of top quality, organic protein sources, as well as loads of protein powders 🍗🥜🍳🌰 Come in and chat with our in-house naturopath to discuss whether you’re getting enough protein in your diet. 💪🏼

PROTEIN. Why is it so important? Not only is it necessary for muscle recovery and repair for those that hit the gym, it’s also a major part of the neurotransmitters we produce that keep us happy and motivated 😊 Without enough protein we don’t have the building blocks to make all the chemicals our brains thrive on, which can lead to depression and mood disorders 😔 Protein also keeps us fuller for longer and stabilises our blood sugar, so by incorporating a palm sized amount with each meal, it will prevent our blood sugar levels spiking and crashing, and avoid hanger and the need to snack throughout the day. Whether you’re vegan, vego, omnivore, or paleo, we have a huge range of top quality, organic protein sources, as well as loads of protein powders 🍗🥜🍳🌰 Come in and chat with our in-house naturopath to discuss whether you’re getting enough protein in your diet. 💪🏼

August 27, 2018

Instagram filter used: Normal Photo taken at: Pachamama Wholefoods +...

⚡️PSA BELOW ⚡️ It’s Sunday morning which means many of you will be heading to your favourite cafes for brunch and might order an almond latte. I wanted to bring everyone’s attention to a certain brand of milk which has infiltrated the Melbourne cafe scene and contains some pretty nasty ingredients. ✅ The first picture here is an almond latte made with our choice of nut milk @pureharvest – it’s not a “barista blend” and only contains pure & natural ingredients ❌ Swipe right to see what kinds of things you might be drinking on a daily basis. Even though I believe cafes should be taking more responsibility not to serve such copious amounts of “numbers” – you can ask and CHOOSE what you put in your body. ✌🏽D x

August 26, 2018

Instagram filter used: Normal Photo taken at: Melbourne, Victoria, Australia...

Join the Pachamigos Club

Sign up to our Pachamigos Club and get free yoga, access to wellness & education events & our instore loyalty program